Sign In | Join Free | My spintoband.com
spintoband.com
Biopro Chemicals Co., Ltd.
Biopro Chemicals Co., Ltd. Growth Hormone Peptides, Anabolic Steroid Chemicals, Natural Bodybuilding Supplements Delivering Safe & Success.
Home > Growth Hormone Peptides >

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Biopro Chemicals Co., Ltd.
Trust Seal
Verified Supplier
Credit Check
Supplier Assessment
Biopro Chemicals Co., Ltd.
City: Shanghai
Province/State: Shanghai
Country/Region: China
Tel: 86-21-30696096
Contact Person:
Mr Johnny

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Brand Name : Biopro
Model Number : GHP-37
Certification : GMP,SGS,BV,ISO
Place of Origin : China
MOQ : Negotiation
Price : Negotiation
Payment Terms : Western Union, MoneyGram, T/T
Supply Ability : Mass in stock
Delivery Time : Within 24 hours after payment
Packaging Details : 1 mg/vial, 10 vials/box
Product name : IGF-1 DES
Synonyms : IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3)
Appearance : White Lyophilized Powder
Purity : 99%min
Specification : 1 mg/vial
Suitable for : Adult, Bodybuilding
Free sample : Yes
Customs pass rate : Guaranteed
Contact Now

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Basic Info.
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3)
Compound: Thr-Leu-Cys-Gly-Ala.
Purity: 99.21%


IGF-1DES Dose
DES IGF-1 can be dosed at 50-150mcg multiple times a day (prior to training) into specific target areas. since DES has such a short half life (20-30 minutes), desensitization was not noticed at all . Injection sites should be localized; preferably, at the muscle group you want to grow. In simple terms, if you want to grow your biceps, inject IGF-1DES right into your bicep.

IGF-1DES Half-life
DES IGF-1 is the shorter version of the IGF-1 chain. It is five (5) times more powerful than IGF-1LR3 and ten (10) times more powerful than regular base IGF-1. The half-life for DES is about 20-30 minutes, which means this is a very delicate chain. Therefore, administration should only be done at the site where you want to see muscle growth. DES has the ability to stimulate muscle hyperplasia better than LR3. In simple terms, it's best used for site injections, rather than overall growth.
In addition, DES is known to bind to receptors that have been deformed by lactic acid, which is often present during workouts. This allows the DES to attach itself to a mutated receptor and signal tissue growth during training. DES can be used longer and more frequently than LR3.


Best Sale

NameSPE
Melanotan I10mg/vial ,10vial/box
Melanotan II10mg/vial ,10vial/box
CJC 12952mg/vial ,10vial/box
cjc1295 dac2mg/vial ,10vial/box
Sermorelin2mg/vial ,10vial/box
Sermorelin5mg/vial ,10vial/box
PT 14110mg/vial ,10vial/box
Ipamorelin2mg/vial ,10vial/box
Ipamorelin5mg/vial ,10vial/box
MGF2mg/vial ,10vial/box
PEG MGF2mg/vial ,10vial/box
GHRP-65mg/vial ,10vial/box
GHRP-25mg/vial ,10vial/box
Hexarelin2mg/vial ,10vial/box
Hexarelin5mg/vial ,10vial/box
Thymosin Beta 4 (TB4)(TB-500)2mg/vial ,10vial/box
Follistatin 3441mg/vial ,10vial/box
Oxytocin 2mg2mg/vial ,10vial/box
epitalon10mg/vial ,10vial/box
DSIP2mg/vial ,10vial/box
DSIP5mg/vial ,10vial/box
selank2mg/vial ,10vial/box
selank5mg/vial ,10vial/box
BPC 1572mg/vial ,10vial/box
Gonadorelin2mg/vial ,10vial/box
Triptorelin GNRH2mg/vial ,10vial/box
ghrh2mg/vial ,10vial/box
Tesamorelin2mg/vial ,10vial/box
ACE0311mg/vial ,10vial/box
GDF-81mg/vial ,10vial/box

Safe Shipping
Factory Supply Peptides Igf-1des Igf-1lr3 for Muscle Building

Other Steroid Hormone Powder:
Testosterone AcetateTrenbolone AcetateMGF
Testosterone CypionateTrenbolone EnanthatePEG MGF
Testosterone DecanoateBoldenone AcetateCJC-1295
Testosterone EnanthateBoldenone undecylenateCJC-1295 DAC
Testosterone IsocaproateBoldenone CypionatePT-141
Testosterone PhenylpropionateBoldenone PropionateMelanotan-1
Testosterone PropionateNandrolone DecanoateMelanotan-2
Testosterone UndecanoateNandrolone phenylpropionateGHRP-2
MesteroneNandrolone undecylateGHRP-6
Testosterone Sustanon 250Nandrolone cypionateIpamorelin
Clostebol AcetateNandrolone propionateHexarelin
MethylandrostanoloneMethyltrienoloneSermorelin
Methenolone EnanthateDrostanolone PropionateOxytocin
Methenolone AcetateDrostanolone EnanthateTB500
AnadrolStanoloneFragment 176-191
AnavarTadalafilTriptorelin
WinstrolVardenafilTesamorelin
Clomifene citrateDianabolGonadorelin
Toremifene citrateTamoxifen CitrateDSIP
FinasterideDapoxetine hydrochlorideSelank


Semi-finished Injectable / Oral steroids:
Test prop-----------100mg/ml 200mg/ml
Test enan-----------250mg/ml 300mg/ml 400mg/ml 500mg/ml 600mg/ml
Test cyp------------200mg/ml 250mg/ml 300mg/ml
Test Sustanon-------200mg/ml 250mg/ml 300mg/ml 400mg/ml
Deca----------------200mg/ml 250mg/ml
Equipoise-----------200mg/ml 300mg/ml
Tren ace------------100mg/ml 200mg/ml
Tren enan-----------100mg/ml 200mg/ml
Dianabol------------50mg/ml
Winstrol------------50mg/ml
Masteron------------100mg/ml 150mg/ml
Primobolone---------100mg/ml
Supertest-----------450mg/ml
Anomass ------------400mg/ml
Ripex---------------225mg/ml
Tritren-------------180mg/ml
Tri Test------------300mg/ml
Tri Deca------------300mg/ml
Test Blend----------450mg/ml 500mg/ml
Nandro Test---------225mg/ml
Mass----------------500mg/ml
Cut Depot-----------400mg/ml
Tren Test-----------225mg/ml
Nandro Test Depot---------450mg/ml
Equi Test-----------------450mg/ml
Rip Cut-------------------175mg/ml
Tren Test Depot-----------450mg/ml


Peptides
HGH 176-1912mg/vial 10vials/kit 1g/bag
GHRP-25mg/vial 10vials/kit 1g/bag
GHRP-210mg/vial 10vials/kit 1g/bag
GHRP-65mg/vial 10vials/kit 1g/bag
GHRP-610mg/vial 10vials/kit 1g/bag
MGF2mg/vial 10vials/kit 1g/bag
PEG MGF2mg/vial 10vials/kit 1g/bag
CJC-1295 with DAC2mg/vial 10vials/kit 1g/bag
CJC-1295 without DAC2mg/vial 10vials/kit 1g/bag
PT-14110mg/vial 10vials/kit 1g/bag
Melanotan-110mg/vial 10vials/kit 1g/bag
Melanotan-210mg/vial 10vials/kit 1g/bag
Ipamorelin2mg/vial 10vials/kit 1g/bag
Hexarelin2mg/vial 10vials/kit 1g/bag
Sermorelin2mg/vial 10vials/kit 1g/bag
Oxytocin2mg/vial 10vials/kit 1g/bag
TB5002mg/vial 10vials/kit 1g/bag
Pentadecapeptide BPC 1572mg/vial 10vials/kit 1g/bag
Triptorelin2mg/vial 10vials/kit 1g/bag
Gonadorelin2mg/vial 10vials/kit 1g/bag
Gonadorelin10mg/vial 10vials/kit 1g/bag
Tesamorelin2mg/vial 10vials/kit 1g/bag
DSIP2mg/vial 10vials/kit 1g/bag
Selank5mg/vial 10vials/kit 1g/bag

Competitive advantages

1 High quality with competitive price
1) Standard: Enterprise Standard
2) All Purity≥98%
3) Manufacturer can provide high quality products with factory price.


2 Fast and safe delivery
1) Sufficient stock&disciplined packing team to make sure prompt and discreet delivery;
2) Experienced and professional logistic agent can provide various transportation ways;
3) Parcel can be sent out in 24 hours after payment. Tracking number available;
4) Customs pass rate ≥99%;

3 After-sale service
Any questions or problems after receiving the product, please feel free to contact us.Problems would be solved immediately.


If you are interested in our products, or if you have any questions, please feel free to contact me, I will reply you at soonest time.

Contact PersonTina
Emailtina@bioproco.com




Product Tags:

Natural Growth Hormone Supplements

      

Peptide Growth Hormone

      
China Customized Inflatable Bumper Ball Game Bubble Adult Grass CE supplier

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Images

Inquiry Cart 0
Send your message to this supplier
 
From:
Enter your email please.
To: Biopro Chemicals Co., Ltd.
Subject:
Message:
Characters Remaining: (0/3000)
 
Inquiry Cart 0